OR7A17 Rabbit Polyclonal Antibody TA337542 from OriGene Technologies | Biocompare.com

Supplier Images

OR7A17 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
OR7A17 Rabbit Polyclonal Antibody

OriGene Technologies' OR7A17 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The OR7A17 Rabbit Polyclonal Antibody was generated using OR7A17 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-OR7A17 Antibody

Product Specs
ItemOR7A17 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA337542
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetOR7A17
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-OR7A17 antibody is: synthetic peptide directed towards the C-terminal region of Human OR7A17. Synthetic peptide located within the following region: ASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYS
NCBI Full Gene Nameolfactory receptor family 7 subfamily A member 17
NCBI Gene AliasesHTPCRX19, BC85395_4
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!